DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and arl5c

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_957140.1 Gene:arl5c / 393819 ZFINID:ZDB-GENE-040426-1866 Length:179 Species:Danio rerio


Alignment Length:176 Identity:115/176 - (65%)
Similarity:145/176 - (82%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVW 65
            ||||.::|..:||:.|||:::||||||||||||||||..|.|.|||||||||||:..:...||||
Zfish     1 MGLLFAKLMTLFGDREHKVIIVGLDNAGKTTILYQFLTKEAVQTSPTIGSNVEEIAIKKTRFLVW 65

  Fly    66 DLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLK 130
            |:|||:||||.|::||||||::|:|:||||||||.||:|||:|||.||||..||:||.|||||::
Zfish    66 DIGGQESLRATWNSYYTNTEIIILVVDSTDRERLTVTKEELHRMLAHEDLQNASVLVLANKQDME 130

  Fly   131 GSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRI 176
            .||:|||||:.|.|:|:....||:|||||||||||...|:|:..|:
Zfish   131 DSMTAAEISQSLTLSSLTARSWHVQACCALTGEGLPASLDWMRSRV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 112/171 (65%)
arl5cNP_957140.1 Arl5_Arl8 3..175 CDD:133353 112/171 (65%)
Ras 18..164 CDD:278499 100/145 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1417432at2759
OrthoFinder 1 1.000 - - FOG0001602
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2407
SonicParanoid 1 1.000 - - X1008
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.