DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and TRIM23

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001647.1 Gene:TRIM23 / 373 HGNCID:660 Length:574 Species:Homo sapiens


Alignment Length:165 Identity:71/165 - (43%)
Similarity:111/165 - (67%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVWDLGGQQSLRAAWSTY 80
            |.::|.:|||.|||||||::...:|.:...||||.|||.|.::|:.|.:||:||:..||..|..|
Human   404 EIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHY 468

  Fly    81 YTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLT 145
            |.||:.|:.|:||:.|:|::....||.::|..::|..|.||::|||||:.|::|..||:   :|.
Human   469 YLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEIT---ELL 530

  Fly   146 SIKK----HQWHIQACCALTGEGLYQGLEWIVQRI 176
            |:.|    ..|:||.|.|.:|.|||:||:|:.:::
Human   531 SLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 71/162 (44%)
TRIM23NP_001647.1 mRING-HC-C3HC3D_TRIM23_C-IX 28..77 CDD:319559
Bbox2_TRIM23_C-IX_rpt1 123..172 CDD:380831
Bbox2_TRIM23_C-IX_rpt2 174..223 CDD:380832
BBC 226..370 CDD:128778
ARF-like 390..574 71/165 (43%)
ARD1 406..574 CDD:206723 70/163 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.