DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl6

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster


Alignment Length:186 Identity:63/186 - (33%)
Similarity:109/186 - (58%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLL--LSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTS---PTIGSNVEE--VVWR 58
            ||:|  |:.|.:: ..::..::::||:|:||::|:..|..:. ..||   ||:|..||:  :...
  Fly     1 MGMLHNLADLIKI-KKDKMTILVLGLNNSGKSSIINHFKKSS-EQTSIVVPTVGFMVEQFYIGMS 63

  Fly    59 NIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSK--ASLL 121
            .:.....|:.|....|..|...:.|...:|.||||:||.|..|.::||..:|||.||..  ..:|
  Fly    64 GVSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPIL 128

  Fly   122 VYANKQDLKGSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRIK 177
            .|.||.|::.|:|:.:|:..|.|.:||...|||.:..|::||||.:|::|::|:::
  Fly   129 FYGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 60/180 (33%)
Arl6NP_611421.1 Arl6 19..182 CDD:206722 57/163 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.