DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arf51F

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster


Alignment Length:177 Identity:80/177 - (45%)
Similarity:118/177 - (66%) Gaps:3/177 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVW 65
            ||.|||::   |||:|.:::|:|||.||||||||:..:.:.|.|.||:|.|||.|.::|:.|.||
  Fly     1 MGKLLSKI---FGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVW 62

  Fly    66 DLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLK 130
            |:|||..:|..|..|||.|:.:|.|:|..||:|:...|.||:|::...::..|.:|::||||||.
  Fly    63 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLP 127

  Fly   131 GSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRIK 177
            .:|...||..:|.||.|:...|::|..||.:|:||.:||.|:....|
  Fly   128 DAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 77/171 (45%)
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 79/175 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102611at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.