DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arfrp1

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster


Alignment Length:179 Identity:65/179 - (36%)
Similarity:96/179 - (53%) Gaps:14/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MFGNEEHKLVMVGLDNAGKTTIL----------YQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVW 65
            |...:::.:|::|||||||||.|          |:.|....:.|  |:|.|:..:..:.:....|
  Fly    12 MTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT--TVGLNIGTIDVQGVRLNFW 74

  Fly    66 DLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLK 130
            ||||||.|::.|..||..:..||.||||.||||:..::....:|:::|.||...||:.||||||.
  Fly    75 DLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLP 139

  Fly   131 GSMSAAEISRQLDLTS--IKKHQWHIQACCALTGEGLYQGLEWIVQRIK 177
            ..|...||........  |.:.........||.|||:.:|::|:|:.||
  Fly   140 DVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 63/175 (36%)
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 60/165 (36%)
Arfrp1 19..186 CDD:206725 62/168 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.