DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl4a

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_062059.1 Gene:Arl4a / 29308 RGDID:2152 Length:200 Species:Rattus norvegicus


Alignment Length:169 Identity:65/169 - (38%)
Similarity:103/169 - (60%) Gaps:10/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVV-----WRNIHFLVWDLGGQQSLRAAWS 78
            :|::|||.|||||:||:...||.|:|.||.|.|.|::.     .:.:.|..||:|||:.||..|.
  Rat    23 IVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWK 87

  Fly    79 TYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLD 143
            :|...|:.::.|:||.|.||:...:.||:::.:..:.....:|:.||||||:.|:|.:||.:.|.
  Rat    88 SYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLA 152

  Fly   144 LTSIKKH-QWHIQACCALTGEGLYQGLE----WIVQRIK 177
            :..:... .||:|..||:.|:||.:|||    .|::|.|
  Rat   153 MGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 63/165 (38%)
Arl4aNP_062059.1 Arl4_Arl7 18..200 CDD:206719 65/169 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.