DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl9

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_017454588.1 Gene:Arl9 / 289565 RGDID:1303337 Length:780 Species:Rattus norvegicus


Alignment Length:147 Identity:51/147 - (34%)
Similarity:83/147 - (56%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LW-RMFGNEEHKLVMV-GLDNAGKTTILYQFLMNEVVH-TSPTIGSNVEEVVW--RNIHFLVWDL 67
            || |.....::|.::| |||.||||::|:....|.|.| |:||:|.|...:..  |.:.||  ::
  Rat   601 LWMRGCAKVKNKQILVLGLDGAGKTSVLHFLASNTVRHSTAPTLGFNAVNISSEDRQMEFL--EI 663

  Fly    68 GGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQ-HEDLSKASLLVYANKQ-DLK 130
            ||.:..|:.|..|.....|:|.|:||.|.:||...::.|::::. :.||   .|:|:|||| ||:
  Rat   664 GGSEPFRSYWDMYLPKGWLLIFVVDSADHKRLPEAKKYLHQLIDPNPDL---PLVVFANKQKDLE 725

  Fly   131 GSMSAAEISRQLDLTSI 147
            .:....:|...|.|:.:
  Rat   726 AAYRITDIHDALALSDV 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 51/147 (35%)
Arl9XP_017454588.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.