DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl5c

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_997114.1 Gene:Arl5c / 217151 MGIID:3028577 Length:179 Species:Mus musculus


Alignment Length:172 Identity:117/172 - (68%)
Similarity:144/172 - (83%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVW 65
            ||.|:::|.|:||::|||:::||||||||||||||||.||||||..||||||||:|.|..|||:|
Mouse     1 MGQLIAKLMRIFGSQEHKVIIVGLDNAGKTTILYQFLTNEVVHTCSTIGSNVEEIVLRKTHFLMW 65

  Fly    66 DLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLK 130
            |||||::||:.|.|||:|.|.||:|||||||.||..||||||:||.||.|..||:|::|||||:|
Mouse    66 DLGGQEALRSTWDTYYSNAEFVILVIDSTDRNRLLTTREELYKMLAHEALQNASVLIFANKQDVK 130

  Fly   131 GSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWI 172
            .||:.||||:.|.|::||.|.||||.|||||||||..||:|:
Mouse   131 DSMTTAEISQFLTLSAIKDHPWHIQGCCALTGEGLPAGLQWM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 115/170 (68%)
Arl5cNP_997114.1 Arl5_Arl8 3..172 CDD:133353 114/168 (68%)
Gem1 18..>138 CDD:224025 84/119 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1417432at2759
OrthoFinder 1 1.000 - - FOG0001602
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1008
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.