DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and ARL4A

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001032241.1 Gene:ARL4A / 10124 HGNCID:695 Length:200 Species:Homo sapiens


Alignment Length:191 Identity:70/191 - (36%)
Similarity:110/191 - (57%) Gaps:14/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGN----EEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVV----- 56
            ||..||....:..|    :...:|::|||.|||||:||:...||.|:|.||.|.|.|::.     
Human     1 MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGN 65

  Fly    57 WRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLL 121
            .:.:.|..||:|||:.||..|.:|...|:.::.|:||.|.||:...:.||:::.:..:.....:|
Human    66 SKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVL 130

  Fly   122 VYANKQDLKGSMSAAEISRQLDLTSIKKH-QWHIQACCALTGEGLYQGLE----WIVQRIK 177
            :.||||||:.|:|.:||.:.|.:..:... .||:|..||:.|:||.:|||    .|::|.|
Human   131 IVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 66/185 (36%)
ARL4ANP_001032241.1 Arl4_Arl7 18..200 CDD:206719 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.