DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab19 and AT5G59840

DIOPT Version :9

Sequence 1:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_200792.1 Gene:AT5G59840 / 836105 AraportID:AT5G59840 Length:216 Species:Arabidopsis thaliana


Alignment Length:209 Identity:92/209 - (44%)
Similarity:133/209 - (63%) Gaps:15/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82
            :|:|.|::||||.|.||:|::.||..|::......|||:||.::||.::||:|||||||||||||
plant    12 YDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

  Fly    83 FRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEE-QREVDF 146
            |||||.:|||.|.|:|:|||:|..|||:|::.||..:.::.:.||..||||||.|::| :|.|..
plant    77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPK 141

  Fly   147 EEARQMC-QYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDANNVEEVPENTITL------- 203
            .:.:.:. :|  .|.| .|||||.|:|||:.|..:|.::| |..|:........||.:       
plant   142 SKGQALADEY--GIKF-FETSAKTNLNVEEVFFSIAKDIK-QRLADTDSRAEPATIKISQTDQAA 202

  Fly   204 --GQGKPLKSCSSS 215
              ||.....:|..|
plant   203 GAGQATQKSACCGS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 83/166 (50%)
AT5G59840NP_200792.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 84/170 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.