DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab19 and RABH1c

DIOPT Version :10

Sequence 1:NP_523970.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_195699.1 Gene:RABH1c / 830148 AraportID:AT4G39890 Length:214 Species:Arabidopsis thaliana


Alignment Length:165 Identity:75/165 - (45%)
Similarity:108/165 - (65%) Gaps:5/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQERFRTI 86
            ||:|.:||...|||.|:.||....:...:..|||:||..||:.:|.:.::||:||||||||||::
plant    10 FKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 74

  Fly    87 TQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTA-SNVLIILVGNKCDLEEQREVDFEEAR 150
            ..||.|.::..::|||::.|.:|.|..||||:|.|... |||:|:|||||.||.|:|:|...|..
plant    75 IPSYIRDSSVAIVVYDVSNRQTFLNTSKWIEDVHRERGQSNVIIVLVGNKTDLVEKRQVSISEGE 139

  Fly   151 QM-CQYIPEILFVMETSAKENMNVEDAFRCLANEL 184
            .. .:|  .::|: |||||||.|::..||.:|..|
plant   140 DKGKEY--GVMFI-ETSAKENFNIKALFRKIAAAL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab19NP_523970.1 Rab19 19..184 CDD:133267 74/163 (45%)
RABH1cNP_195699.1 Rab6 10..171 CDD:206654 74/163 (45%)

Return to query results.
Submit another query.