DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab19 and Rab13

DIOPT Version :9

Sequence 1:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_080953.1 Gene:Rab13 / 68328 MGIID:1927232 Length:202 Species:Mus musculus


Alignment Length:197 Identity:87/197 - (44%)
Similarity:130/197 - (65%) Gaps:4/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82
            :|.|||::||||.|.||||::.||...|:...:.:|||:||.::|:.:|||:||||:||||||||
Mouse     5 YDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQER 69

  Fly    83 FRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFE 147
            |:|||.:|||.|.|:::|||||...||.|:|.|::.::...::.|..:|:|||||:|.:|:|..|
Mouse    70 FKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQRE 134

  Fly   148 EARQMCQYIPEILFVMETSAKENMNVEDAFRCLANE--LKRQHDANNVEEVPENTITLGQGKPLK 210
            :|.::.:. ..|.| .|||||.::||::||..||.:  ||.....:.....|.:|......|...
Mouse   135 QAEKLARE-HRIRF-FETSAKSSVNVDEAFSSLARDILLKTGGRRSGTNSKPSSTGLKTSDKKKN 197

  Fly   211 SC 212
            .|
Mouse   198 KC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 81/166 (49%)
Rab13NP_080953.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 81/167 (49%)
RAB 9..170 CDD:197555 79/162 (49%)
Effector region. /evidence=ECO:0000250 37..45 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..202 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.