Sequence 1: | NP_001261575.1 | Gene: | Rab19 / 38930 | FlyBaseID: | FBgn0015793 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057614.1 | Gene: | RAB8B / 51762 | HGNCID: | 30273 | Length: | 207 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 86/198 - (43%) |
---|---|---|---|
Similarity: | 131/198 - (66%) | Gaps: | 17/198 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82
Fly 83 FRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFE 147
Fly 148 EARQMCQYIPEILFVMETSAKENMNVEDAFRCLANEL-----KRQHDANNVEEVPENTITLGQGK 207
Fly 208 PLK 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab19 | NP_001261575.1 | Rab19 | 19..184 | CDD:133267 | 80/164 (49%) |
RAB8B | NP_057614.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 80/167 (48%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 3/7 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |