DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab19 and rab-10

DIOPT Version :9

Sequence 1:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_491857.1 Gene:rab-10 / 266836 WormBaseID:WBGene00004273 Length:201 Species:Caenorhabditis elegans


Alignment Length:217 Identity:89/217 - (41%)
Similarity:131/217 - (60%) Gaps:26/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ARNPQTLMALPNEEHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEG 67
            ||.|           :|.|||::||||.|.|||||:.||....:.....:|||:||.:|||.::|
 Worm     2 ARRP-----------YDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKG 55

  Fly    68 KQIKLQIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILV 132
            |:||||||||||||||.|||.||||.|.|:::|||||...||.|:.||:..:..:.:.:|:.:::
 Worm    56 KKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMIL 120

  Fly   133 GNKCDLEEQREVDFEEARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDANNVEEVP 197
            |||||:.::|.|..|...::.|  ...:...|||||.|::|:.||..||..:        :.::|
 Worm   121 GNKCDMSDRRVVSRERGEKIAQ--DHGISFHETSAKLNVHVDTAFYDLAEAI--------LAKMP 175

  Fly   198 ENT-----ITLGQGKPLKSCSS 214
            ::|     .|:...:|.:..||
 Worm   176 DSTDEQSRDTVNPVQPQRQSSS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 80/164 (49%)
rab-10NP_491857.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 80/175 (46%)
RAB 10..173 CDD:197555 78/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.