DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab19 and Rab8b

DIOPT Version :9

Sequence 1:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_038936858.1 Gene:Rab8b / 266688 RGDID:628764 Length:208 Species:Rattus norvegicus


Alignment Length:208 Identity:88/208 - (42%)
Similarity:133/208 - (63%) Gaps:18/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82
            :|:|||::||||.|.||||::.||....:.....:|||:||.::||.::||:|||||||||||||
  Rat     5 YDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQER 69

  Fly    83 FRTITQSYYRSA-NGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDF 146
            |||||.:|||.| .|:::|||||...||.|::.||..:..:.:|:|..:::|||||:.::|:|..
  Rat    70 FRTITTAYYRGAMQGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSK 134

  Fly   147 EEARQMCQYIPEILFVMETSAKENMNVEDAFRCLANEL-----KRQHDANNVEEVPENTITLGQG 206
            |...::.  |...:..:|||||.:.|||:||..||.::     ::.:|:|          :.|.|
  Rat   135 ERGEKLA--IDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSN----------SSGAG 187

  Fly   207 KPLKSCSSSCNLT 219
            .|:|...|....|
  Rat   188 GPVKITESRSKKT 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 80/165 (48%)
Rab8bXP_038936858.1 Rab8_Rab10_Rab13_like 6..173 CDD:206659 80/168 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.