DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab19 and RAB26

DIOPT Version :10

Sequence 1:NP_523970.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_055168.2 Gene:RAB26 / 25837 HGNCID:14259 Length:256 Species:Homo sapiens


Alignment Length:177 Identity:77/177 - (43%)
Similarity:122/177 - (68%) Gaps:11/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHG---NTIGVDFSMKTIAVEGKQIKLQIWDT 77
            :.:|..||::|:||.|.||||::.|||.|.::.  |   :|:|:||..|.:.|:|.::|||:|||
Human    58 DFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLA--GTFISTVGIDFRNKVLDVDGVKVKLQMWDT 120

  Fly    78 AGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQR 142
            |||||||::|.:|||.|:.:|::||:|.::||.|:|.|:.|:..|...:|.::|:|||.|...:|
Human   121 AGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHER 185

  Fly   143 EVDFEEARQMC-QY-IPEILFVMETSAKENMNVEDAFRCLANELKRQ 187
            .|..|:..::. :| :|    .||||||..:||:.||..:|.|||::
Human   186 VVKREDGEKLAKEYGLP----FMETSAKTGLNVDLAFTAIAKELKQR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab19NP_523970.1 Rab19 19..184 CDD:133267 74/169 (44%)
RAB26NP_055168.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Rab26 64..254 CDD:206695 76/171 (44%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 86..101 4/16 (25%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 119..136 12/16 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.