DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab19 and RAB35

DIOPT Version :9

Sequence 1:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_011536081.1 Gene:RAB35 / 11021 HGNCID:9774 Length:276 Species:Homo sapiens


Alignment Length:33 Identity:11/33 - (33%)
Similarity:13/33 - (39%) Gaps:10/33 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TASNVLIILVGNKCDLEEQREVDFEEARQMCQY 155
            |||:|          |..||.|....|...||:
Human   134 TASSV----------LRRQRHVLAASAASPCQW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 11/33 (33%)
RAB35XP_011536081.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.