DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7201 and CG34428

DIOPT Version :10

Sequence 1:NP_648200.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:258 Identity:58/258 - (22%)
Similarity:92/258 - (35%) Gaps:70/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HIRKKR--LIWITDDGRLALPPGTSLT---FVPTIAMPL----VRHPPEGFFSNLTISFPVTIDF 120
            |.|.||  :.|:       :.|.||.|   |:..|.:||    ......|:...:....|.|.|.
  Fly    27 HQRSKRAPIPWL-------IYPTTSPTRVMFIGGIGIPLEDLNYEAVTTGYVLKVEYWLPTTPDD 84

  Fly   121 ----DKLGLTDNQNPLGDLPPLFARSFGHEAGHMVGEYVARYLHVQRRKRDLSEQRSRSNEDHPF 181
                ..|.||....|                    |...||            :||....|:...
  Fly    85 LRTPTALPLTQVATP--------------------GVTGAR------------KQRKPMFENFLV 117

  Fly   182 RIHEEGPKYPELPAGLQHIFHGGERVLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSLEKF--- 243
            .:.|.|....:|......:. ...|..:|..:|......|..|:.|:|::|||   .:.|.|   
  Fly   118 GVDELGKNTRKLLTRTNKVL-SSYRWTVYKGLEGLADRLGYQGRICVLKSICE---AAEEPFHYT 178

  Fly   244 -GVFGEMTKLFLTVTK-----SPFSDLVPDYVQAQEVGEGKQAPGECFPYFKDCPKSIFKALS 300
             |:|.::..:.||.:.     |..:|  .:|..|:::|   |:...|...||:|.:|:.:..|
  Fly   179 NGLFADLLHILLTPSSSVDKLSEHAD--NEYYYAEKMG---QSGAGCDRVFKECRRSLLQHFS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7201NP_648200.1 DM4_12 201..298 CDD:214785 27/105 (26%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 27/102 (26%)

Return to query results.
Submit another query.