DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7201 and CG34184

DIOPT Version :9

Sequence 1:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster


Alignment Length:212 Identity:53/212 - (25%)
Similarity:85/212 - (40%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GFFSNLTISFPVTIDFDKLGLTDNQNPLGDLPPLFARSFGHEAGHMVGEYVARYLHVQRRKR--- 166
            |.|  :.||.|:|:        .|:|       :|. |:.:|..:...|:|.:|..:.....   
  Fly    30 GIF--MAISVPLTL--------KNRN-------VFL-SYNYEFNYYQPEHVYKYPPILMGDNWED 76

  Fly   167 -----------DLSEQRS-RSNEDHPFRIHEEGPKYPELPAGLQHIFHGGERVLLYGVVEDFLST 219
                       |.|..|| ||.:|:      ...:...||.        ..|...|.:::|.|..
  Fly    77 SYLTYNTTGGDDSSSSRSFRSVDDN------SSTQKRTLPI--------MSRTNFYIMLKDKLER 127

  Fly   220 FGMDGKACLLRTICEMHSRSL-EKFGVFGEMTKLFLTVTKSPFSDLVPDYVQAQEVGEGKQAPGE 283
            .|...::||||.|||.:|.:| |..|:.|.:..:..|.:.|...:|..||.||:..|   ...|:
  Fly   128 SGYPAESCLLRLICETNSSTLGEVNGLLGSIVHILFTPSSSNDENLDKDYYQAEWDG---LRHGD 189

  Fly   284 CFPYFKDCPKSIFKALS 300
            |..|...|.:::...:|
  Fly   190 CSFYASQCEENVLDLIS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 29/97 (30%)
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.