DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7201 and CG5768

DIOPT Version :9

Sequence 1:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster


Alignment Length:302 Identity:62/302 - (20%)
Similarity:102/302 - (33%) Gaps:103/302 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PNALALNRQADAGQALDMAAQLADAEAEARPDYDADSPD----TPHIRKKRLIWITDDGR----L 80
            |..:.:..:||              ::.|.....|.||:    :.|:..:|  |.....|    |
  Fly   174 PTLMTMMERAD--------------DSTASTSTFASSPESLVTSSHLLHRR--WQRALSRPKRYL 222

  Fly    81 ALPPGTSLTFVPTIAMPLVRHPPEGFFSNLTISFPVTIDFDKLGLTDNQNPLGDLPPLFARSFGH 145
            :.|.|:|.:......:.::.:|..|              ::..||  |.....|||..       
  Fly   223 SFPEGSSFSVAVCFTVGIIGNPYYG--------------YNSFGL--NWGVAYDLPNT------- 264

  Fly   146 EAGHMVGEYVARYLHVQRRKRDLSEQRSRSNEDHPFRIHEEGPKYPELPAGLQHIFHGGERVLLY 210
                   .:|.::|                   |.|..|      |..||.|:.    ..|..:|
  Fly   265 -------TWVLQHL-------------------HGFATH------PVAPAVLRR----RSRSAIY 293

  Fly   211 GVVEDFLSTFGMDGKACLLRTICEMHSRSL---EKFGVFGEMTKLFLTVTKSPF--------SDL 264
            ..:|..:...|.:|:.|:|||:||  ||..   .|..:.|||.:...::.|...        :|:
  Fly   294 RQIEAVVDNMGYNGRDCILRTLCE--SRQYFQRTKMSMVGEMLRTIFSLPKQRIFTRELHENADI 356

  Fly   265 VPDYVQAQEVGEGKQAPGECFPYFKDCPKSIFKALSSKYSKP 306
            | .|.||..    .....:|..|  :|..|:.:....||:.|
  Fly   357 V-HYDQAYR----NAHTDDCTQY--NCHFSLLELAFGKYTTP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 27/107 (25%)
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.