DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7201 and CG17780

DIOPT Version :9

Sequence 1:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:196 Identity:37/196 - (18%)
Similarity:67/196 - (34%) Gaps:66/196 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PLVRHPPEGFFSNLTISFPVTIDFDKLG------------------------LTDNQNPLGDLPP 137
            ||.:|......|..|.:.| :.|||...                        .|:.:|.|..:..
  Fly    41 PLSKHFDSHMVSPSTSNIP-SSDFDSASGNSTRILRRGKRYLQFSKGSRMSWRTNGKNNLWTINT 104

  Fly   138 LFARSFGHEAGHMVGEYVARYLHVQRRKRDLSEQRSRSNEDHPFRIHEEGPKYPELPAGLQHIFH 202
            |:|..:|..|.:       .:..::.:|:|.:..         ||:.:..               
  Fly   105 LYAYGYGFRANY-------PFPSIEEQKKDNAVF---------FRLFKRD--------------- 138

  Fly   203 GGERVLLYGVVEDFLSTFGMDGKACLLRTICEMHS---RSLEKFGVFGEMTKLFLTVTKSPFSDL 264
                  |:..:|..|...|.||:||:|::.|...:   ...:|.|:..:|.||.....|. :.|:
  Fly   139 ------LFSKLETALDGHGFDGRACMLKSFCTAINDVDNPKQKSGMLFKMLKLIFRRAKR-YLDI 196

  Fly   265 V 265
            :
  Fly   197 I 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 17/68 (25%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 15/72 (21%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.