DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7201 and CG13613

DIOPT Version :9

Sequence 1:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster


Alignment Length:228 Identity:52/228 - (22%)
Similarity:91/228 - (39%) Gaps:55/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GRLALPPGTSLTFVPTIAMPLVRHPPEGFFSNLTISFPVTIDFDKLGLTDNQNPLGDLPPLFARS 142
            |.|..|..|.|....:|::|          ::|.....|.:|   :|...|.|    |||..:..
  Fly    28 GLLLFPTSTVLQLTSSISIP----------ADLNTRTKVFMD---MGFQMNYN----LPPTVSAF 75

  Fly   143 FGHEAGHMVGEYVARYLHVQRRKRDLSEQRSRSNEDHPFRIHEEGPKYP-ELPAGLQHIFHGGER 206
            :.   ..:..:.::|     |:||.|......:.:.:..    ||..:| :..||          
  Fly    76 YN---ATIWADELSR-----RQKRQLDHSLDANLQQYDL----EGGMHPADFTAG---------- 118

  Fly   207 VLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSLEKFGVFGEMTKL--FLTVTKSPFSDLVPD-- 267
             .||..:|:.|.|:|.. ::||||::||:......:...:|.:|::  || :|.|.......|  
  Fly   119 -QLYKGIENMLETYGFH-RSCLLRSVCELALHPFAEDHFYGMVTQVITFL-LTPSQHEGFADDEQ 180

  Fly   268 -----YVQAQEVGEGKQAPGECFPYFKDCPKSI 295
                 |.:|:::|   ...|:|...:..|...|
  Fly   181 HYRDKYEKAEQIG---FLGGQCHLSYPSCQADI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 26/104 (25%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.