DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7201 and CG14115

DIOPT Version :10

Sequence 1:NP_648200.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster


Alignment Length:193 Identity:42/193 - (21%)
Similarity:67/193 - (34%) Gaps:65/193 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TVLVFVCFLVERAIYRFGKWLKKTRRKALFTSLEKMKEELMLLGLISLLLSQSARWISEICVNSS 88
            |||:.:|||                  .|:..||      :|||.:.:|||.:..     |....
  Fly   145 TVLLSLCFL------------------HLYVELE------ILLGPLKVLLSMALG-----CDLEP 180

  Fly    89 LFNSKFYICSEEDYGIHKKVLLEHTSSTNQSSLPHHGIHE-----ASHQCGHGREPFVSYEGLEQ 148
            .||..:...|.:|:...:..|:       .||:...||:.     .......|...|:.|     
  Fly   181 QFNKPYLATSLQDFWGRRWNLM-------VSSVLRSGIYNPVRCACQRPMNSGWARFMGY----- 233

  Fly   149 LLRFLFVLGITHVLYSGIAIGLAMSKIYSWRK---WEAQAI-----IMAESDIHAKKTKVMKR 203
            |:.|| |.|:.|.|.          ..|..|:   ||....     :...:::..|:|..::|
  Fly   234 LVTFL-VSGLFHELV----------YFYITRETPTWEVTLFFVLNGVCTGTEVAVKRTAFLQR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7201NP_648200.1 DM4_12 201..298 CDD:214785 1/3 (33%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 25/104 (24%)

Return to query results.
Submit another query.