DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and OSH7

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_011863.1 Gene:OSH7 / 856389 SGDID:S000001043 Length:437 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:44/206 - (21%)
Similarity:70/206 - (33%) Gaps:86/206 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 RNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTS 235
            ::||||..:    |.:||   :|.|.:               .|...::.::.:||         
Yeast   292 KDLREKSSK----KTVLF---DTHQHF---------------PLAPKVRPLEEQGE--------- 325

  Fly   236 GVLTTLQHCLEIIAESDESWKRKLER--------------EIDKRRRSEDQSKKLKDEVE---KM 283
                         .||...||:..:.              :|:.|:| |...|:.:|.||   |:
Yeast   326 -------------YESRRLWKKVTDALAVRDHEVATEEKFQIENRQR-ELAKKRAEDGVEFHSKL 376

  Fly   284 KRLSYPGPDFEEGPHSTLPEDEFFDAVETGLDKIEEDMQLRFKLKLQSQISQTLVNVPHEAVAEG 348
            .|.:.||.|.:...:..:||         |.||.||            ||...|...|   :..|
Yeast   377 FRRAEPGEDLDYYIYKHIPE---------GTDKHEE------------QIRSILETAP---ILPG 417

  Fly   349 EEAREEFGTGA 359
            :...|:|...|
Yeast   418 QTFTEKFSIPA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594
PH_GPBP 42..142 CDD:270100
START_STARD11-like 363..601 CDD:176881
OSH7NP_011863.1 Oxysterol_BP 53..393 CDD:395990 29/145 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.