DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and SBF2

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001373268.1 Gene:SBF2 / 81846 HGNCID:2135 Length:1881 Species:Homo sapiens


Alignment Length:153 Identity:44/153 - (28%)
Similarity:70/153 - (45%) Gaps:29/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTNAGESLGASPPSSN---EAAAGSQSQ-SDASEEEEYLDNSIELRGYLSKWTNYIYGWQPRYIV 62
            |::.||...:|...||   ..||...|| :..::|....:.::..||.|.|      ||:||:.|
Human  1740 DSSMGEEQNSSISPSNGVERRAATLYSQYTSKNDENRSFEGTLYKRGALLK------GWKPRWFV 1798

  Fly    63 LKDGT---LSYYKSESESDFGCRGAISLTKATI----------KAHESDELRFDVVVN-NLNNWC 113
            | |.|   |.||  :|..|..|:|.|.|.:..:          ..|.||:..||:..: .:.|:|
Human  1799 L-DVTKHQLRYY--DSGEDTSCKGHIDLAEVEMVIPAGPSMGAPKHTSDKAFFDLKTSKRVYNFC 1860

  Fly   114 LRAETSEDRMHWVDVLQLYKADS 136
              |:..:....|:|.:|...:|:
Human  1861 --AQDGQSAQQWMDKIQSCISDA 1881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 31/103 (30%)
PH_GPBP 42..142 CDD:270100 33/109 (30%)
START_STARD11-like 363..601 CDD:176881
SBF2NP_001373268.1 uDENN 1..86 CDD:214824
DENN 116..298 CDD:396629
dDENN 352..420 CDD:129037
SBF2 531..754 CDD:403522
PH-GRAM_MTMR13 882..1000 CDD:275416
PTP-MTMR13 1138..1517 CDD:350437
Required for homodimerization and interaction with MTMR2. /evidence=ECO:0000250|UniProtKB:E9PXF8, ECO:0000269|PubMed:15998640 1661..1714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1706..1726
PH_Sbf1_hMTMR5 1774..1879 CDD:269941 33/115 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.