DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and ACD11

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_181016.1 Gene:ACD11 / 818034 AraportID:AT2G34690 Length:206 Species:Arabidopsis thaliana


Alignment Length:198 Identity:43/198 - (21%)
Similarity:71/198 - (35%) Gaps:72/198 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTS 143
            |||.|.         |.:..|:.:...|::|    :||.:|...:    |:.:.|    ..:...
plant    47 FGCLGI---------AFKFAEMDYVAKVDDL----VRASSSISTL----VVMMDK----DIEADC 90

  Fly   144 LRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNN 208
            :|:.||                  .|:..||.|.| |:..| :||.||        ..||     
plant    91 VRKAGS------------------HTRNLLRVKRG-LDMVK-VLFEQI--------IASE----- 122

  Fly   209 AQPLDLGD-GLKSIDFKGESITF---------RATTSGV--LTTLQHCLEIIAESDESWKRKLER 261
                  || .||....|..:..|         :|.:.|:  |.|..|.|.::.|.:.:.|..::.
plant   123 ------GDNSLKDPATKSYAQVFAPHHGWAIRKAVSLGMYALPTRAHLLNMLKEDEAAAKIHMQS 181

  Fly   262 EID 264
            .::
plant   182 YVN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 12/50 (24%)
PH_GPBP 42..142 CDD:270100 13/62 (21%)
START_STARD11-like 363..601 CDD:176881
ACD11NP_181016.1 GLTP 34..170 CDD:285880 41/182 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10219
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.