DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and PLEKHA3

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_061964.3 Gene:PLEKHA3 / 65977 HGNCID:14338 Length:300 Species:Homo sapiens


Alignment Length:329 Identity:79/329 - (24%)
Similarity:139/329 - (42%) Gaps:67/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVV 106
            :.|.|.|||||:.|||||:.||.:|.||||.|:.:...|.:|:|.:....||.|.:|..|.::::
Human     1 MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELII 65

  Fly   107 NNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQR 171
            ....::.::|..:.:|..|:..|...||  ..|||.:.:..                 .:.:|..
Human    66 PGEQHFYMKAVNAAERQRWLVALGSSKA--CLTDTRTKKEK-----------------EISETSE 111

  Fly   172 NLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTSG 236
            :|:.|:.||..:.|:|..|:.|:|.:.......:..:|:.::....|.|           ||.:.
Human   112 SLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLS-----------ATCNT 165

  Fly   237 VLTTLQHCLEI------------------IAESDESWKRKLEREIDK--RRRSEDQSKKLKDEVE 281
            .:|||:.|::|                  ::....|..:.::|.:..  ...||..|..:|:.|.
Human   166 FITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVS 230

  Fly   282 KMKRLS------YPGPDFEEGPHSTLPEDEFFDAVETGLDKIEEDM-------QLRFKLKLQSQI 333
            .:.|||      |...|    ..|.:|.::....|....:.:..|:       :.|...|.||:.
Human   231 TLHRLSQRRRRTYSDTD----SCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSES 291

  Fly   334 SQTL 337
            ..||
Human   292 EDTL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 31/87 (36%)
PH_GPBP 42..142 CDD:270100 36/99 (36%)
START_STARD11-like 363..601 CDD:176881
PLEKHA3NP_061964.3 PH_FAPP1_FAPP2 1..100 CDD:269951 37/100 (37%)
Interaction with SACM1L. /evidence=ECO:0000269|PubMed:30659099 1..100 37/100 (37%)
Interaction with VAPA and VAPB. /evidence=ECO:0000269|PubMed:30659099 97..300 44/231 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..300 22/103 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.