DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and PCTP

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001317307.1 Gene:PCTP / 58488 HGNCID:8752 Length:219 Species:Homo sapiens


Alignment Length:252 Identity:49/252 - (19%)
Similarity:98/252 - (38%) Gaps:55/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 VAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHYAREGVGQDGNGWQIFADEGEIKMYKREEE 409
            :|.|..:.|:|           |    ..|.|....|..|.     .||:..:...|.:|:..::
Human     3 LAAGSFSEEQF-----------W----EACAELQQPALAGA-----DWQLLVETSGISIYRLLDK 47

  Fly   410 VNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTLEDCTILEKISADTLLFLQTHKRIWP 474
            ..||.  ..|.:..::..:...:...:...::|..|:..::: ...::.:.:|:::.:. |..:|
Human    48 KTGLY--EYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKE-LYEQECNGETVVYWEV-KYPFP 108

  Fly   475 ASQRDAQFWSHMRKITDNLEPGARDMWVVCNNSTEYAKQESKNGKCVRI-FLTVILACQTHLPEG 538
            .|.||   :.::|:..| |:...|.:.|:...||...:...::| .:|: .....||.::...:|
Human   109 MSNRD---YVYLRQRRD-LDMEGRKIHVILARSTSMPQLGERSG-VIRVKQYKQSLAIESDGKKG 168

  Fly   539 YVKGQPLNRNDLTCKITYCSVVNPGG--------WAPASALR----AVYKREYPKFL 583
                         .|:......||||        ||..:..|    |..:|:..|||
Human   169 -------------SKVFMYYFDNPGGQIPSWLINWAAKNQSRTKREAQNQRDLIKFL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594
PH_GPBP 42..142 CDD:270100
START_STARD11-like 363..601 CDD:176881 45/234 (19%)
PCTPNP_001317307.1 START_STARD2-like 4..194 CDD:176919 43/231 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.