DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and stard15

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001011090.1 Gene:stard15 / 496503 XenbaseID:XB-GENE-942501 Length:266 Species:Xenopus tropicalis


Alignment Length:217 Identity:40/217 - (18%)
Similarity:84/217 - (38%) Gaps:44/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 QDGNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTLED 451
            ::..||....::|.:.::..|::....| ..||...|.:.|.|..:........:|..|::.:.:
 Frog    18 ENHEGWHCQYNKGGVTVWSEEQDSTKAV-KKLKMCITCKDVPAEILYDVLHDTSYRKKWDSNMIE 81

  Fly   452 CTILEKISADTLLFLQTHKRIWPASQRD---AQFWSHMRKITDNLEPGARDMWVVCNNSTEYAKQ 513
            ...:.:::.:..:...:.|...|...||   .:.|.          |...| :::.|.|.::.|.
 Frog    82 TYDIGRLTVNADIGYYSWKCPSPLKNRDFVTLRSWL----------PLGND-YMIINYSVKHPKH 135

  Fly   514 ESKNGKCVRIFLTVILACQTHLPEGY-VKGQPLNRNDLTCKITYCSVVNPGGWAP---------- 567
            ..:......:.|      ||    || :|....|    :|.:.|.:.|:|.|..|          
 Frog   136 PPRKDYVRAVSL------QT----GYLIKANGSN----SCSLYYLTQVDPRGSLPKWVVNKVSQF 186

  Fly   568 --ASALRAVYKR--EYPKFLKR 585
              ..|::.:||.  :||::.::
 Frog   187 VAPKAMKKIYKAGIKYPEWKRK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594
PH_GPBP 42..142 CDD:270100
START_STARD11-like 363..601 CDD:176881 40/217 (18%)
stard15NP_001011090.1 START_STARD10-like 2..221 CDD:176880 40/217 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.