DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and Osbp

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_477271.1 Gene:Osbp / 42985 FlyBaseID:FBgn0020626 Length:784 Species:Drosophila melanogaster


Alignment Length:551 Identity:125/551 - (22%)
Similarity:207/551 - (37%) Gaps:110/551 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVV 105
            |::|:|.||||||.|:|.|:.||..|.||||:::||.:..|||.|||..|.|  |..|...|.:.
  Fly    16 EMKGWLLKWTNYIKGYQRRWFVLSKGVLSYYRNQSEINHTCRGTISLHGALI--HTVDSCTFVIS 78

  Fly   106 VNNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQ 170
            ......:.::|.|..:|..||..|:|.||       .::|........::.|..:.....:....
  Fly    79 NGGTQTFHIKAGTEVERQSWVTALELAKA-------KAIRAIECEEEEETETAHVVPSQEISSVV 136

  Fly   171 RNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTS 235
            |:|.:::..:.|..|::......|||   |.:::..|..:  .||...|.::.:  :..||.|::
  Fly   137 RDLTDRLESMRTCYDLITKHGAALQR---ALNDLETNEEE--SLGSRTKIVNER--ATLFRITSN 194

  Fly   236 GVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSE---DQSKKLKDEVEKM-------KRLSYPG 290
            .::......|.........|.:.|..|.::|:|.|   :|..|.:.::|:.       |.:|...
  Fly   195 AMINAGNDYLHTAEAQGHKWSKMLHHEREQRQRLEEIIEQMAKQQSQMEQAAVLVRQNKPVSSTS 259

  Fly   291 PDFEEGPHSTLPED-EFFDAVE---TGLDKIEEDMQLR---FKLKLQSQISQTLVNVPHEAVAEG 348
            .....|...|..|: |||||.|   :|..:..|.....   |.||:..:.|.:...|........
  Fly   260 GAGTAGSLVTSDEEMEFFDAEEHGYSGSGRSPESSDCERGTFILKMHKRRSSSEDQVEGHLEGSS 324

  Fly   349 EEAREEFGTGAEATSHALWPEIDRVCKEQL-HYAREGVGQD------------------GNGWQI 394
            .|:.|:..|         ...:.:||.... ..|..|.|.|                  |..|  
  Fly   325 SESDEQKRT---------VQTVQQVCLVSAPRVASGGQGDDDDDVDKALPAKESTDSIYGRNW-- 378

  Fly   395 FADEGEIKMYKREEEVNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFR----------NDWE--- 446
              :...||  ||.:.|......|:..:..::....:::........|.          .|:|   
  Fly   379 --NPDLIK--KRRDRVPDKPNHPISLWGIMKNCIGKDLSKIPMPINFNEPLSMLQRLVEDYEYTE 439

  Fly   447 ------TTLEDCTILEKISADTL-LFLQTHKR-----------IWPASQRDAQFWSHMRKITDNL 493
                  |..::|..|..|:|.|: .:..|..|           .:...:.|...|..:.:...:.
  Fly   440 ILDYAATCQDECEQLAYIAAFTVSAYATTTNRTGKPFNPLLGETYECDRMDDYGWRCLAEQVSHH 504

  Fly   494 EPGARDMWVVCNNSTEYAKQESKNGKCVRIF 524
            .|.|.   :.|         ||||..|.:.|
  Fly   505 PPVAA---LHC---------ESKNWTCWQEF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 37/88 (42%)
PH_GPBP 42..142 CDD:270100 40/99 (40%)
START_STARD11-like 363..601 CDD:176881 36/212 (17%)
OsbpNP_477271.1 PH 15..107 CDD:278594 39/92 (42%)
PH_OSBP_ORP4 17..113 CDD:270101 41/104 (39%)
Oxysterol_BP 399..764 CDD:279564 22/137 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I3888
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.