DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and Osbp

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001102397.1 Gene:Osbp / 365410 RGDID:1308069 Length:682 Species:Rattus norvegicus


Alignment Length:507 Identity:103/507 - (20%)
Similarity:181/507 - (35%) Gaps:169/507 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYKADS----GSTDT 141
            |||.|:|..|.|..  .|...|.:.......:.|:|.:..:|..||..|:|.||.:    ..:|.
  Rat     5 CRGTINLATANITV--EDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDE 67

  Fly   142 TSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNK 206
            :.          ...::|.|....|:.|.|.|..||.:|.|..|::......|||   :.||: :
  Rat    68 SG----------DEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQR---SLSEL-E 118

  Fly   207 NNAQPLDLGDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSED 271
            :...|.:..:.:|.::.:  :..||.|::.::...:..|.:.....:.|::.|:.|.|:|.|.|:
  Rat   119 SLKLPAESNEKIKQVNER--ATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEE 181

  Fly   272 QSKKLKDEVEKMKRLSYPGPDFEEGPHSTLP--------------------------EDEFFDAV 310
            ..::|..:...::| ::.|.       :.||                          |:|||||.
  Rat   182 TLEQLAKQHNHLER-AFRGA-------TVLPANTPGSTGSGKEQCCSGKGDMSDEDDENEFFDAP 238

  Fly   311 E------------TG-------------------LDKIEEDMQLRFKLK----------LQSQIS 334
            |            ||                   |::.:::.:.|...|          :::.|.
  Rat   239 EIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKNCIG 303

  Fly   335 QTLVNVP---------------------HEAV---AEGEEAREE-----------FGTGAEATSH 364
            :.|..:|                     ||.:   |:.|.:.|:           :.|....||.
  Rat   304 KELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSK 368

  Fly   365 ALWP------EIDR--------VCKEQLHY--AREGVGQDGNGWQIFADEGEIKMYKREEEVNG- 412
            ...|      |:||        :|::..|:  |.....:..|||.:   ..|||:   ..:..| 
  Rat   369 PFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTL---RQEIKI---TSKFRGK 427

  Fly   413 -LVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWE--TTLEDCTILEKISAD 461
             |.:.||...|.:...|..   ||        .|:  ||.....|:.|:..|
  Rat   428 YLSIMPLGTIHCIFHATGH---HY--------TWKKVTTTVHNIIVGKLWID 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 14/48 (29%)
PH_GPBP 42..142 CDD:270100 19/64 (30%)
START_STARD11-like 363..601 CDD:176881 28/119 (24%)
OsbpNP_001102397.1 PH-like <1..64 CDD:302622 18/60 (30%)
PH <3..56 CDD:278594 16/52 (31%)
Oxysterol_BP 293..662 CDD:279564 38/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.