DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and Def6

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001178646.1 Gene:Def6 / 309642 RGDID:1307945 Length:630 Species:Rattus norvegicus


Alignment Length:415 Identity:87/415 - (20%)
Similarity:153/415 - (36%) Gaps:122/415 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NAGESLGASPPSSNEAAAGSQSQSDASEE--EEYLDNSIELRGYLSKWTNYIYGWQPRYIVLKDG 66
            |:|..|         ...|..|.|.|.:|  :|.:.:.:: :|||.|..:....|..|:..|:..
  Rat   189 NSGRCL---------RGVGQDSLSMAIQEVYQELIQDVLK-QGYLWKRGHLRRNWTERWFQLQPS 243

  Fly    67 TLSYYKSESESDFGC---RGAISLTKATIKAH---------ESDELRFDVVVNNLNNWCLRAETS 119
            .|.|:.||.     |   ||.|.|     .||         |.....|.|...: ..:.:.|..:
  Rat   244 CLCYFGSEE-----CKEKRGTIPL-----DAHCCVEVLPDREGKRCMFCVKTAS-RTYEMSASDT 297

  Fly   120 EDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLRE--------- 175
            ..|..|...:|         ....|:..|.| ||..:         ||:.:|..||         
  Rat   298 RQRQEWTAAIQ---------TAIRLQAEGKT-SLHKD---------LKQKRREQREQRERRRAAK 343

  Fly   176 -----KVGELETFKDILFGQIETL---QRYFDAC--SEVNKNNAQPLDLGDGLKSIDFKGESITF 230
                 ::.:|:..|:....::|.|   ||..:..  .|..:..:|..:|...|:....:.|..  
  Rat   344 EEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQA-- 406

  Fly   231 RATTSGVLTTLQHCLEI-----------IAESDESWKR---KLEREIDKRRRSED-----QSKKL 276
            ||       ::|..:|:           |||.:|..:|   .|:.|: |.||.|:     |::.|
  Rat   407 RA-------SMQAEMELKKEEAARQRQRIAELEEMQERLQEALQLEV-KARRDEEAVRLAQTRLL 463

  Fly   277 KDEVEKMKRLSYPGPDFEEGPHSTLPEDEFFDAVETGLDKIEEDMQLRFKLKLQSQISQTLVNVP 341
            ::|.||:|:|.          |....::.:.:..:....:::::|.|:.:...|:|         
  Rat   464 EEEEEKLKQLM----------HLKEEQERYIERAQQEKQELQQEMALQSRSLQQAQ--------- 509

  Fly   342 HEAVAEGEEAREEFGTGAEATSHAL 366
             :.:.|..:.|:......||....|
  Rat   510 -QQLEEVRQNRQRADEDVEAAQRKL 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 24/101 (24%)
PH_GPBP 42..142 CDD:270100 25/111 (23%)
START_STARD11-like 363..601 CDD:176881 1/4 (25%)
Def6NP_001178646.1 PH_SWAP-70 210..319 CDD:270092 28/129 (22%)
Smc <341..>551 CDD:224117 43/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.