DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and Osbpl11

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001100560.1 Gene:Osbpl11 / 303888 RGDID:1307294 Length:754 Species:Rattus norvegicus


Alignment Length:373 Identity:92/373 - (24%)
Similarity:153/373 - (41%) Gaps:67/373 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NAG-ESLGA--SPPSSNEAAAGSQSQSDASEEEEYLDNSIELRGYLSKWTNYIYGWQPRYIVLKD 65
            |:| .|.|.  |..|||.:..||      ::..:|.|:...:.|||.|:||.:.|||.|:.||.:
  Rat    37 NSGNSSCGGVISSSSSNNSRGGS------TKGWQYSDHMESVNGYLMKYTNLVTGWQYRFFVLNN 95

  Fly    66 --GTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDV 128
              |.|.|:.:|...:...||.:.|..|.|...:.|...|.|...:...:.|||..:::|.|||..
  Rat    96 EAGLLEYFVNEQSRNQKPRGTLQLAGAVISPSDEDSHTFTVNAASGEQYKLRATDAKERQHWVSR 160

  Fly   129 LQLYKADSGSTDTTSLRRHGSTMS-----LQSNTISLTSGGSLKKTQRNLREKVGELETFKDILF 188
            ||:           ..:.|...:.     |:|.:.||.|.|:...:||...:..   .:|.::..
  Rat   161 LQI-----------CTQHHTEAIGKNNPPLKSRSFSLASSGNSPISQRRPSQNA---ISFFNVGH 211

  Fly   189 GQIETLQR----YFDACSEVNK----NNAQPLDL--------GDG-LKSIDFKGESITFRATTSG 236
            .:::::.:    :.|...||.:    ...|..||        ..| |.|:|  .:.:..:||:..
  Rat   212 SKLQSVNKRAHLHPDHLVEVREMMSHAEGQQRDLIRRIECLPASGLLSSLD--QDLLMLKATSMA 274

  Fly   237 VLTTLQHCLEIIAESDESWKRK----------LEREIDKRRRSEDQSKKLKDEVEKMKRLSYPGP 291
            .:..|..|..|:.....|.::.          ||.:|......::.::: ....|..|..:.| .
  Rat   275 TMNCLNDCFHILQLQHASHQKGALPSGTTIEWLEPKIPLSNHYKNGAEQ-PFATEPSKPAAAP-E 337

  Fly   292 DFEEGPHSTLPED-EFFDAVETGLDKIEEDM-----QLRFKLKLQSQI 333
            ..|.|..:..||| ...|.:|...|..|:|:     |....|.|.||:
  Rat   338 AAESGGLAREPEDINADDEIEDTCDNKEDDLGAVEEQRSVILHLLSQL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 31/91 (34%)
PH_GPBP 42..142 CDD:270100 33/101 (33%)
START_STARD11-like 363..601 CDD:176881
Osbpl11NP_001100560.1 PH_ORP10_ORP11 72..178 CDD:270106 34/116 (29%)
PH 74..164 CDD:278594 33/100 (33%)
Oxysterol_BP 380..740 CDD:279564 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.