DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and CG30392

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster


Alignment Length:207 Identity:36/207 - (17%)
Similarity:71/207 - (34%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EEEYLD-NSIELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKS-----------------ESESD 78
            |...|| :.::|..||:.:...:     ::..|.....|:..|                 |.:..
  Fly    30 ETSLLDEDDVQLDAYLAAYEEIM-----KFFQLMGSVFSFVSSDVRSKIDILYALRAKDAEEQEH 89

  Fly    79 FGC----------------RGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVD 127
            |..                :|.:|.::..::.|..    .|.|...||    |.:...|....||
  Fly    90 FNTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRG----LDFVYEFLN----RIQAIPDDQKTVD 146

  Fly   128 VLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIE 192
            |.:....|:.....:.|.|.|:.:::.:..   |.|..|||.       ..::|..|:.|...::
  Fly   147 VCKEAYDDTLGKHHSFLIRKGARLAMYAMP---TRGDLLKKV-------CSDVEAAKENLPSMLK 201

  Fly   193 TLQRYFDACSEV 204
            .::..:|...::
  Fly   202 HMRTNYDRTEDL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 20/122 (16%)
PH_GPBP 42..142 CDD:270100 21/132 (16%)
START_STARD11-like 363..601 CDD:176881
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 28/166 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10219
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.