DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and OSBP2

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_110385.1 Gene:OSBP2 / 23762 HGNCID:8504 Length:916 Species:Homo sapiens


Alignment Length:461 Identity:109/461 - (23%)
Similarity:178/461 - (38%) Gaps:121/461 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNN 108
            |:|.|||||:.|:|.|:.||.:|.||||:::.|....|||.|:|:.|.|...:|..:   ::.:.
Human   187 GWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRGTINLSTAHIDTEDSCGI---LLTSG 248

  Fly   109 LNNWCLRAETSEDRMHWVDVLQLYKA-----------DSGSTDTTSLRRHGSTMSLQSNTISLTS 162
            ..::.|:|.:..||..|:..|:|.||           |||..|..:.....|             
Human   249 ARSYHLKASSEVDRQQWITALELAKAKAVRVMNTHSDDSGDDDEATTPADKS------------- 300

  Fly   163 GGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGES 227
              .|..|.:||..|:.:|.|..|::......|||   :.:|:           ||||.....||.
Human   301 --ELHHTLKNLSLKLDDLSTCNDLIAKHGAALQR---SLTEL-----------DGLKIPSESGEK 349

  Fly   228 I--------TFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSKKLKDEVEKMK 284
            :        .||.|::.::...:..||:.......|:|.|:.|.::|...|:..::|..:...::
Human   350 LKVVNERATLFRITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLE 414

  Fly   285 RLSY--------PGPDFEE-------GPHSTLPED-EFFDAVETGLDKIEEDMQLRFKLKLQSQI 333
            |..:        |...|.|       |..|...|| |:|||:|.                     
Human   415 RAFHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMED--------------------- 458

  Fly   334 SQTLVNVPHEAVAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHYAREGVGQDGNGWQIFADE 398
            |.:.:.|..||..:..:|.     |:..||...|...|.|.             ||..   ...:
Human   459 STSFITVITEAKEDSRKAE-----GSTGTSSVDWSSADNVL-------------DGAS---LVPK 502

  Fly   399 GEIKMYKREEEVNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTLEDCTILEKISADTL 463
            |..|: ||...:.......|..:..::....||:........|.       |..::|::::.|  
Human   503 GSSKV-KRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFN-------EPLSMLQRLTED-- 557

  Fly   464 LFLQTH 469
              |:.|
Human   558 --LEYH 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 31/85 (36%)
PH_GPBP 42..142 CDD:270100 39/108 (36%)
START_STARD11-like 363..601 CDD:176881 19/107 (18%)
OSBP2NP_110385.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..163
PH_OSBP_ORP4 185..280 CDD:270101 35/95 (37%)
PH 186..274 CDD:278594 33/89 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..301 5/33 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..448 5/30 (17%)
Oxysterol_BP 522..896 CDD:279564 8/51 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 813..842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.