Sequence 1: | NP_001286978.1 | Gene: | cert / 38928 | FlyBaseID: | FBgn0027569 | Length: | 601 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032822.2 | Gene: | Pctp / 18559 | MGIID: | 107375 | Length: | 214 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 41/197 - (20%) |
---|---|---|---|
Similarity: | 81/197 - (41%) | Gaps: | 23/197 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 389 GNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTLEDCT 453
Fly 454 ILEKISADTLLFLQTHKRIWPASQRDAQFWSHMRKITDNLEPGARDMWVVCNNSTEYAKQESKNG 518
Fly 519 KCVRI-FLTVILACQTHLPEGYVKGQPLNRNDLTCKITYCSVVNPGGWAPASALRAVYKREYPKF 582
Fly 583 LK 584 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cert | NP_001286978.1 | PH | 40..130 | CDD:278594 | |
PH_GPBP | 42..142 | CDD:270100 | |||
START_STARD11-like | 363..601 | CDD:176881 | 41/197 (21%) | ||
Pctp | NP_032822.2 | START_STARD2-like | 8..210 | CDD:176919 | 41/197 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |