DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and obr-2

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_506695.2 Gene:obr-2 / 180003 WormBaseID:WBGene00008832 Length:436 Species:Caenorhabditis elegans


Alignment Length:255 Identity:46/255 - (18%)
Similarity:81/255 - (31%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 KLEREIDKRRRSEDQSKKLKDEVEKMKRLSYP-------------------GPDFEEGPHSTLPE 303
            ||.||.......:.|:.|.:..:.|.:|...|                   |.||.   ..|:| 
 Worm     3 KLFREKKDMGSPKIQNFKRQTVLHKGQRTRLPATYIAPEDVSIWDIIRPNLGKDFS---RFTVP- 63

  Fly   304 DEFFDAVETGLDKIEEDMQLRFKLKLQSQISQTLVNVPHEAVAEGEEAREEFGTGAEATSH---- 364
             .|.:...:.|.::.|::|..:.|:..::.|..:..:.:.|.         |.....:.:|    
 Worm    64 -VFMNEPLSFLQRLSENVQYNYLLEKAAKCSDDMERIEYVAA---------FALATVSANHKRLS 118

  Fly   365 ----ALWPEIDRVCKEQLHYAREGVGQDGNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHTVQ 425
                .|..|...:.:..:.:..|.|........::|:..|..:....|...|..|..|.|..   
 Worm   119 KPFNPLLLETFELERNGVRFLAEQVSHHPPISAVYAESDEFTVEGTVEPTLGFWMTKLLANP--- 180

  Fly   426 GVTAREMCHYFFMPEFRNDWET---TLEDCTILEKISADTLLFLQTHKRIWPASQRDAQF 482
                    |......|:...||   :...|.|...|.....:...:|.:|..:...||.|
 Worm   181 --------HAHLKLTFKKTGETYSWSAPKCAIYNVIMGKMYMNFTSHMKIESSGTYDAVF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594
PH_GPBP 42..142 CDD:270100
START_STARD11-like 363..601 CDD:176881 24/131 (18%)
obr-2NP_506695.2 Oxysterol_BP 44..401 CDD:279564 37/214 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.