DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and AgaP_AGAP011883

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_320642.3 Gene:AgaP_AGAP011883 / 1280776 VectorBaseID:AGAP011883 Length:214 Species:Anopheles gambiae


Alignment Length:173 Identity:52/173 - (30%)
Similarity:72/173 - (41%) Gaps:29/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NSIELRGYLSKWTNYIYGWQPRY--IVLKDGTLSYY--------KSESESDFGC--RGAISLTKA 90
            |..:|.|.|.|:||.:.|||.|:  :..:.|.||||        .|.|....|.  ||.:.|..|
Mosquito    12 NRQQLSGQLYKYTNVMKGWQYRWFSVDAQGGLLSYYLCEPAGEDSSSSSHIVGSTPRGQVHLAGA 76

  Fly    91 TIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQ-LYKADSGSTDTT-----SLRRH-- 147
            .|...:.|...|.|...:.:...|||..:..|..|||.|: :.::.|.||.|.     .|..|  
Mosquito    77 VICPSDEDSKTFTVNCASGDMLKLRAVDARARQEWVDGLRAVVESHSNSTGTALPPRDQLAAHDA 141

  Fly   148 --GSTMSLQSNTISLTSGGSLKKTQRNLREKVGEL-ETFKDIL 187
              .:...||...:   |..:|.:...||   .|.| .|..|:|
Mosquito   142 FGAARQQLQQTEL---SNAALARAIENL---AGPLSNTDPDLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 33/101 (33%)
PH_GPBP 42..142 CDD:270100 37/112 (33%)
START_STARD11-like 363..601 CDD:176881
AgaP_AGAP011883XP_320642.3 PH_ORP10_ORP11 16..123 CDD:270106 34/106 (32%)
PH 17..120 CDD:278594 33/102 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.