DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cert and AgaP_AGAP003366

DIOPT Version :9

Sequence 1:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_314268.5 Gene:AgaP_AGAP003366 / 1275043 VectorBaseID:AGAP003366 Length:2205 Species:Anopheles gambiae


Alignment Length:146 Identity:28/146 - (19%)
Similarity:57/146 - (39%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GASPPS------SNEAAAGSQSQSDASEEEEY--LDNSI----ELRGYLSKWTNYIYGWQPRYIV 62
            |.:.|:      .|.:.:.|.:.::.:.:..|  .|:.:    ...|||.|....:..|:.|:.|
Mosquito  2058 GGNQPTLARTQGDNNSVSSSVNTTNTNSQHYYEQYDSKVADDRTHEGYLYKRGAILKNWKQRWFV 2122

  Fly    63 LKD--GTLSYYKSESESDFGCRGAISLTK-----------ATIKAHESDELRFDVVVNNLNNWCL 114
            |..  ..|.||  ::..|..|:|.|.|.:           |...:.:.|:..|..:..:...:..
Mosquito  2123 LDSHKHQLRYY--DTMDDCSCKGYIELAEVQSVAQAPPQTAPAPSKKIDDRAFFDLKTSRRTYNF 2185

  Fly   115 RAETSEDRMHWVDVLQ 130
            .|:.:.....|::.:|
Mosquito  2186 YAQEASSAQEWIEKIQ 2201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
certNP_001286978.1 PH 40..130 CDD:278594 21/106 (20%)
PH_GPBP 42..142 CDD:270100 22/102 (22%)
START_STARD11-like 363..601 CDD:176881
AgaP_AGAP003366XP_314268.5 uDENN 1..85 CDD:214824
DENN 134..317 CDD:280329
dDENN 403..471 CDD:129037
SBF2 583..829 CDD:289132
PH-GRAM_MTMR5_MTMR13 958..1076 CDD:275396
Myotub-related 1214..1701 CDD:284109
C1_1 2001..2050 CDD:278556
PH_Sbf1_hMTMR5 2099..2205 CDD:269941 22/105 (21%)
PH 2101..2204 CDD:278594 22/103 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.