DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and EIF4E2

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_004837.1 Gene:EIF4E2 / 9470 HGNCID:3293 Length:245 Species:Homo sapiens


Alignment Length:178 Identity:63/178 - (35%)
Similarity:104/178 - (58%) Gaps:21/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KHPLEHTWTLWHLENDRT-------KRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMV 123
            :|||::.:|.|:  :.||       :.:.:.:..:.:|.:||.|:..|..:..|.||...:|:.:
Human    53 EHPLQYNYTFWY--SRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHL 115

  Fly   124 FKKNIRPMWEDDTNKNGGRWILLLDK--ASRTYIDKMWHDLLLCMIGECFQHSDEICGVVINVRN 186
            ||:.|:||||||.|||||:||:.|.|  |||     .|.:|:|.|:||.|...:||||.|::||.
Human   116 FKEGIKPMWEDDANKNGGKWIIRLRKGLASR-----CWENLILAMLGEQFMVGEEICGAVVSVRF 175

  Fly   187 KANKLSLWTKDSRNVEAILSIGRQIKELLHL---GIMEIQYQVHKDAM 231
            :.:.:|:|.|.:.:......|...::.:|:|   .|||  |:.|.|::
Human   176 QEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIME--YKTHTDSI 221

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 57/164 (35%)
EIF4E2NP_004837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
EIF4EBP1/2/3 binding. /evidence=ECO:0000269|PubMed:17368478 54..57 2/2 (100%)
IF4E 55..214 CDD:396291 59/167 (35%)