DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eIF4E3

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_174252.2 Gene:eIF4E3 / 839836 AraportID:AT1G29590 Length:240 Species:Arabidopsis thaliana


Alignment Length:218 Identity:76/218 - (34%)
Similarity:117/218 - (53%) Gaps:19/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DPNDWSHGLAV---YDGLELMSGNEEELQPS---LNRVMKNIDYDLAMKHPLEHTWTLWHLENDR 82
            |||..:....:   ...::.:||:|:  .||   .|...|.....:...|..:::||.| .:|..
plant    18 DPNTTTSPSPIEKHVSAIKAISGDEK--APSKEKKNYASKKSTTVIQKSHCFQNSWTFW-FDNPS 79

  Fly    83 TKR----WAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRW 143
            :|.    |...|..:.:|.|:|:|:|:|..:.||:.....:|...||..|.|.|||....|||:|
plant    80 SKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPICANGGKW 144

  Fly   144 ILLLDKASRTYIDKMWHDLLLCMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIG 208
            .:...:|:   ::..|.:.||.::||.|...|||||.|:|.|.:.:::|||||.:.|.||.||||
plant   145 TMFFPRAT---LESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIG 206

  Fly   209 RQIKELLHLGIME-IQYQVHKDA 230
            :|.|||  ||..: |.:.||:||
plant   207 KQWKEL--LGYNDTIGFIVHEDA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 61/157 (39%)
eIF4E3NP_174252.2 IF4E 67..221 CDD:366742 61/158 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.