DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and AT1G29550

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_174248.1 Gene:AT1G29550 / 839832 AraportID:AT1G29550 Length:240 Species:Arabidopsis thaliana


Alignment Length:222 Identity:80/222 - (36%)
Similarity:119/222 - (53%) Gaps:27/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DPNDWS-------HGLAVYDGLELMSGNEEELQPS---LNRVMKNIDYDLAMKHPLEHTWTLWHL 78
            |||..:       |..|:    :.:||:|:  .||   .|...|.....:...|..:::||.| .
plant    18 DPNTTTSPSPKEKHVSAI----KAISGDEK--APSKEKKNYASKKSTTVIQKSHCFQNSWTFW-F 75

  Fly    79 ENDRTKR----WAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKN 139
            :|..:|.    |...|..:.:|.|:|:|:|:|..:.||:......|...||..|.|.|||....|
plant    76 DNPSSKSNQVIWGSSLRSLYTFGTIEEFWSLYNNIHPPTKWVSGADLYCFKDKIEPKWEDPICAN 140

  Fly   140 GGRWILLLDKASRTYIDKMWHDLLLCMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAI 204
            ||:|.::..||:   ::..|.:.||.::||.|...|||||.|:|.|.:.:::|||||::.|.||.
plant   141 GGKWSMMFPKAT---LECNWLNTLLALVGEQFDQGDEICGAVLNFRARGDRISLWTKNAANEEAQ 202

  Fly   205 LSIGRQIKELLHLGIME-IQYQVHKDA 230
            ||||:|.|||  ||..| |.:.||:||
plant   203 LSIGKQWKEL--LGYNETIGFIVHEDA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 63/157 (40%)
AT1G29550NP_174248.1 IF4E 67..221 CDD:396291 63/159 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.