DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and EIF4E

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_193538.1 Gene:EIF4E / 827529 AraportID:AT4G18040 Length:235 Species:Arabidopsis thaliana


Alignment Length:192 Identity:77/192 - (40%)
Similarity:103/192 - (53%) Gaps:19/192 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GNEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTK----RWAEMLVDVTSFNTVEDFF 103
            ||.:|...|          .:...|||||:||.| .:|...|    .|...|..|.:|:|||:|:
plant    46 GNVDESSKS----------GVPESHPLEHSWTFW-FDNPAVKSKQTSWGSSLRPVFTFSTVEEFW 99

  Fly   104 SVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIG 168
            |:|..:|.||.|....|:..||..|.|.|||....|||:|.:...|...   ||.|...||.:||
plant   100 SLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTFPKEKS---DKSWLYTLLALIG 161

  Fly   169 ECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIMEIQYQVHKDA 230
            |.|.|.|||||.|:|:|.|..::|:|||::.|..|.:|||:|.||.|... ..|.:.:|:||
plant   162 EQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYN-NSIGFIIHEDA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 66/156 (42%)
EIF4ENP_193538.1 IF4E 61..216 CDD:396291 69/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.