DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_038952114.1 Gene:Eif4e1b / 686104 RGDID:1585494 Length:263 Species:Rattus norvegicus


Alignment Length:205 Identity:85/205 - (41%)
Similarity:120/205 - (58%) Gaps:11/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AVYDGLELMSGNEEELQPSLNRVMKNIDYDLAMK-----HPLEHTWTLWHLENDRTKRWAEMLVD 92
            |..:||:   |...:|..||..|.:....:...|     |||:..|.||..:|||::.|.:.|..
  Rat    47 ATAEGLQ---GEARDLPGSLKTVKQKAQREHPTKLPRELHPLQFRWVLWFFKNDRSRAWQDNLQL 108

  Fly    93 VTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASR-TYID 156
            ||.|:|||||::.|..||..|.|....||.:||:.|:|||||..||.||||:|.|.|..| ..:|
  Rat   109 VTKFDTVEDFWATYRHVKLASKLSCGCDYALFKEGIQPMWEDSRNKRGGRWLLSLAKQQRHMELD 173

  Fly   157 KMWHDLLLCMIGECF-QHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIM 220
            ::|.:.|||::||.| ::|.|:||.|:|:|.|.:|::|||.::.|...::.||...||.|.|...
  Rat   174 RLWLETLLCLLGESFEEYSGEVCGAVVNIRTKGDKIALWTSEAENKAGVMHIGHIYKERLGLSTK 238

  Fly   221 E-IQYQVHKD 229
            . |.||.|.|
  Rat   239 TIIGYQAHAD 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 69/155 (45%)
Eif4e1bXP_038952114.1 IF4E 84..243 CDD:396291 71/158 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.