DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eif4e1c

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_005156696.1 Gene:eif4e1c / 550549 ZFINID:ZDB-GENE-050417-398 Length:230 Species:Danio rerio


Alignment Length:220 Identity:88/220 - (40%)
Similarity:135/220 - (61%) Gaps:6/220 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GLAVYDGLEL--MSGNE-EELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTKRWAEMLVD 92
            ||..:...:|  |.|.| ||::......:.....:..:||||::.|.||:.:||::|.|.|.|..
Zfish    11 GLGSFRASQLPEMRGTETEEVRSDSPTAVVTTSPEQYIKHPLQNRWALWYFKNDKSKSWTENLRL 75

  Fly    93 VTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASR-TYID 156
            ::.|:|||||:::|..::.||.|....||.:||..|:||||||.||.||||::.|.|..| ..:|
Zfish    76 ISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLD 140

  Fly   157 KMWHDLLLCMIGECF-QHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIM 220
            :.|.:.|||:|||.| :.|:::||.|:|||.|.:|:::||.:.:|.:||::||:|.||.|.|...
Zfish   141 RYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYKERLSLPSK 205

  Fly   221 E-IQYQVHKDAMVNHGPNVNAIYTL 244
            . |.||.|.|.....|.....:|::
Zfish   206 TLIGYQSHDDTSSKSGSTTKNMYSV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 70/155 (45%)
eif4e1cXP_005156696.1 IF4E 54..210 CDD:279921 70/155 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573588
Domainoid 1 1.000 193 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3585
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.