DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eif4e2

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001016076.1 Gene:eif4e2 / 548830 XenbaseID:XB-GENE-5823950 Length:212 Species:Xenopus tropicalis


Alignment Length:189 Identity:62/189 - (32%)
Similarity:108/189 - (57%) Gaps:17/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KHPLEHTWTLWHLEND-----RTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFK 125
            :|||::.:|.|:....     .|..:.:.:....:..:||.|:.:|..:..|.||..::|:.:||
 Frog    31 EHPLQYKYTFWYSRRTPSRPASTHNYEQNIRQFGTVASVEQFWRIYSHIVRPGDLTGYSDFHLFK 95

  Fly   126 KNIRPMWEDDTNKNGGRWILLLDK--ASRTYIDKMWHDLLLCMIGECFQHSDEICGVVINVRNKA 188
            ..|:|||||:.|||||:||:.|.|  |||     .|.:::|.|:||.|...:||||||:::|.:.
 Frog    96 DGIKPMWEDEANKNGGKWIIRLRKGLASR-----FWENIILAMLGEQFMVGEEICGVVVSIRFQE 155

  Fly   189 NKLSLWTKDSRNVEAILSIGRQIKELLHL---GIMEIQYQVHKDAMVNHGPNVNAIYTL 244
            :.||:|.|.:.:..:.:.|...::.:|:|   .|||  |:.|.|::.::....|...|:
 Frog   156 DILSIWNKTANDQFSTVRIRDTLRRVLNLPPNTIME--YKTHTDSLKDNSSFRNTKITV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 54/162 (33%)
eif4e2NP_001016076.1 IF4E 33..192 CDD:396291 56/165 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.