DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eif4e3

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001016049.1 Gene:eif4e3 / 548803 XenbaseID:XB-GENE-992071 Length:218 Species:Xenopus tropicalis


Alignment Length:205 Identity:49/205 - (23%)
Similarity:94/205 - (45%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PSLNRVMKNIDYDLAMKH-----------------PLEHTWTLW---HLENDRTKRWAEMLVDVT 94
            |:..|:....|..|.:.|                 ||...||.|   .|...........|..:.
 Frog     7 PADRRLQPEPDEQLHLNHRELGELALPQEPDTEGIPLHSPWTFWLDRSLPGTTAAECESNLKKIY 71

  Fly    95 SFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMW 159
            :.:|::.|:|||..:...::|.:...|.:.:...:|:||:::|..||.|.:.:.|.:.:.:   |
 Frog    72 TVHTIQSFWSVYNNIPQVTNLPLRWSYHLMRGERKPLWEEESNAKGGVWKMKVPKEASSLV---W 133

  Fly   160 HDLLLCMIGECFQH----SDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELL-HLGI 219
            .:|||..|||.|..    .||:.||.::||::.:.:.:|..:: :|....::..:|.||| :...
 Frog   134 KELLLATIGEQFTDRCAPEDEVIGVSVSVRDREDVVQVWNGNA-SVVGEATVLEKIYELLPNTSF 197

  Fly   220 MEIQYQVHKD 229
            ..:.|:.|::
 Frog   198 KAVFYKPHEE 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 40/160 (25%)
eif4e3NP_001016049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/12 (25%)
IF4E 45..198 CDD:279921 40/156 (26%)