DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eif4e

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001015909.1 Gene:eif4e / 548663 XenbaseID:XB-GENE-855435 Length:214 Species:Xenopus tropicalis


Alignment Length:203 Identity:80/203 - (39%)
Similarity:124/203 - (61%) Gaps:7/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGLELMSGNEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVE 100
            :|....|..||:.:.|    .:.:..|..:||||::.|.||..:||::|.|...|..::.|:|||
 Frog     7 EGTNPQSTEEEKTETS----QEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVE 67

  Fly   101 DFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKAS-RTYIDKMWHDLLL 164
            ||:::|..::..|:|....||.:||..|.|||||:.||.||||::.|:|.. |..:|:.|.:.|:
 Frog    68 DFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLM 132

  Fly   165 CMIGECF-QHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHL-GIMEIQYQVH 227
            |:|||.| ::||::||.|:|||.|.:|:::||.:..|.:|:..||:..||.|.| ..:.|.||.|
 Frog   133 CLIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVVIGYQSH 197

  Fly   228 KDAMVNHG 235
            .|.....|
 Frog   198 ADTATKSG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 65/155 (42%)
eif4eNP_001015909.1 IF4E 38..194 CDD:279921 65/155 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3317
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 212 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9344
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.