DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eif4e2

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001014815.2 Gene:eif4e2 / 541523 ZFINID:ZDB-GENE-050327-59 Length:236 Species:Danio rerio


Alignment Length:198 Identity:67/198 - (33%)
Similarity:109/198 - (55%) Gaps:18/198 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLEND-----RTKRWAEMLVDVTSFNTVEDFF 103
            |:|| ....|...:......|.:|||::.:|.|:....     .|:.:.:.:..:.||.:||.|:
Zfish    31 NDEE-DKEANTTKRKAVVPGAGEHPLQYNYTFWYSRRTPGRPASTQSYEQNIKQIGSFASVEQFW 94

  Fly   104 SVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDK--ASRTYIDKMWHDLLLCM 166
            ..|..:..|.||...:|:.:||:.|:||||||.||:||:||:.|.|  |||     .|.:|:|.|
Zfish    95 RFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIIRLRKGLASR-----CWENLILAM 154

  Fly   167 IGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHL---GIMEIQYQVHK 228
            :||.|...:||||.|::||.:.:.:|:|.|.:.:......|...::.:|:|   .|||  |:.|.
Zfish   155 LGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIME--YKTHT 217

  Fly   229 DAM 231
            |::
Zfish   218 DSI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 56/162 (35%)
eif4e2NP_001014815.2 IF4E 54..212 CDD:307672 56/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.