DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eif4e3

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001004589.1 Gene:eif4e3 / 447850 ZFINID:ZDB-GENE-040912-156 Length:224 Species:Danio rerio


Alignment Length:193 Identity:52/193 - (26%)
Similarity:87/193 - (45%) Gaps:16/193 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLW---HLENDRTKRWAEMLVDVTSFNTVEDFFSV 105
            :|.||:...|.|......      ||...||.|   .|...........|..:.:.:||:.|:||
Zfish    30 DERELENITNHVEDGTSL------PLHSPWTFWLDRSLPGTTAAECESNLKKIYTVHTVQSFWSV 88

  Fly   106 YYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGEC 170
            |..:.|.|.|.:...|.:.:...||:||:::|..||.|.:.:.|.|...:   |.:|||..|||.
Zfish    89 YNNIPPVSCLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKESTLAV---WKELLLATIGEQ 150

  Fly   171 F----QHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIMEIQYQVHKD 229
            |    ...||:.||.::||.:.:.:.:|..::........:||..:.|..:....:.|:.|::
Zfish   151 FTDYCASEDEVVGVSVSVREREDVVQVWNGNASFANEANVLGRIYELLPQISFKAVFYKPHEE 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 43/159 (27%)
eif4e3NP_001004589.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
IF4E 51..198 CDD:279921 42/149 (28%)